McDonnell Genome Institute

Washington University

Transcript

lnc-ZDHHC17-10:1

Chromosome

chr12

Gene Name

lnc-ZDHHC17-10

Start

76599670

CPC Label

coding

End

76600470

Cancer

EOGC

Strand

+

Peptide

LVEAIRTNSSDR

Modified Peptide

n[145]LVEAIRTNSSDR

Peptide Length

12

ORF Length

149

Open Reading Frame (ORF)

LRRKLPAKGMSPTKRSPVLRAGVNAITTLVECKMAQLVVMAHHVDPIELVVFLPVLCHKMGFPHCIIKGKARLGCLVHRKTSTTVAFTEVNSEDKGALAKLVEAIRTNSSDRYDEIHCHWGGNVLGPKSVAHFAKLEKAKVNELAIKLG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.832008

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.0886

PhyloCSF Frame 3

0

CNTI Score

0.671017346