McDonnell Genome Institute

Washington University

Transcript

lnc-ZDHHC15-2:1

Chromosome

chrX

Gene Name

lnc-ZDHHC15-2

Start

75537546

CPC Label

noncoding

End

75538702

Cancer

CCRC

Strand

-

Peptide

ILLVAAGFNEDEGSQPEAMPPEAK

Modified Peptide

n[230]ILLVAAGFNEDEGSQPEAMPPEAK

Peptide Length

24

ORF Length

82

Open Reading Frame (ORF)

MTKKASAISIKLRLSKPKLASKILLVAAGFNEDEGSQPEAMPPEAKMRIKNIGRNTLTSAGPNSFNKRSVCFLLTKSYGSKI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.263547

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9625

PhyloCSF Frame 3

0

CNTI Score

-0.317882927