McDonnell Genome Institute

Washington University

Transcript

lnc-ZDHHC13-1:3

Chromosome

chr11

Gene Name

lnc-ZDHHC13-1

Start

19241160

CPC Label

noncoding

End

19250307

Cancer

OV

Strand

+

Peptide

TPDLMIWPPQPPK

Modified Peptide

n[145]TPDLM[147]IWPPQPPK

Peptide Length

13

ORF Length

92

Open Reading Frame (ORF)

LLFFFETESCSVTQAGVQWCDLGSLQPLPPGFKQFSCLSLSSNWDYRCAPPRPANFCIFSRDGVSPYWPGWSRTPDLMIWPPQPPKVLGLQA

Conservation Score

0.091

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.218297

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9339

PhyloCSF Frame 3

0

CNTI Score

0.726220602