McDonnell Genome Institute

Washington University

Transcript

lnc-ZDHHC11B-3:1

Chromosome

chr5

Gene Name

lnc-ZDHHC11B-3

Start

765242

CPC Label

noncoding

End

785687

Cancer

OV

Strand

-

Peptide

EGRPTPEQLR

Modified Peptide

n[145]EGRPTPEQLR

Peptide Length

10

ORF Length

144

Open Reading Frame (ORF)

LREGRPTPEQLRWAPGTDPSPCSGRSPAALSPPGSPVPWVRPALGSEHPHSPALPLPCTVCGSLKNWARSGLAPHCPRGPAANPPHPRRPRPRSSIPRRTVNARPAGRRDRGPVVPGGPQRQVRGLAATAHLRGRGLPPRPASP

Conservation Score

0.587

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0704713

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3241

PhyloCSF Frame 3

0

CNTI Score

-0.296708401