McDonnell Genome Institute

Washington University

Transcript

lnc-ZDHHC11-4:1

Chromosome

chr5

Gene Name

lnc-ZDHHC11-4

Start

763379

CPC Label

noncoding

End

764114

Cancer

BRCA-Luminal A

Strand

-

Peptide

LLIMNSVSLIK

Modified Peptide

n[145]LLIM[147]NSVSLIK

Peptide Length

11

ORF Length

47

Open Reading Frame (ORF)

LDFSPSATVSLVGRLLIMNSVSLIKKLFCFSVFLFLFSYFLLLLLFF

Conservation Score

0.179

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0208581

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6679

PhyloCSF Frame 3

0

CNTI Score

-0.384217182