McDonnell Genome Institute

Washington University

Transcript

lnc-ZDHHC11-1:1

Chromosome

chr5

Gene Name

lnc-ZDHHC11-1

Start

858878

CPC Label

noncoding

End

860235

Cancer

PRAD

Strand

-

Peptide

QAGIGAHPSR

Modified Peptide

‚Äč

Peptide Length

10

ORF Length

36

Open Reading Frame (ORF)

LVQVRAAKQVGRQGGGGRQAGIGAHPSRGLVRPVFL

Conservation Score

0.483

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.119873

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9946

PhyloCSF Frame 3

0

CNTI Score

-0.292890494