McDonnell Genome Institute

Washington University

Transcript

lnc-ZDBF2-2:2

Chromosome

chr2

Gene Name

lnc-ZDBF2-2

Start

206252446

CPC Label

noncoding

End

206264556

Cancer

OV

Strand

+

Peptide

SDSPLDTQTAGGR

Modified Peptide

n[145]SDSPLDTQTAGGR

Peptide Length

13

ORF Length

43

Open Reading Frame (ORF)

MLVQTLDVKSDSPLDTQTAGGRWFPSGPELPTRPLSETQLDVS

Conservation Score

0.046

PhyloCSF Frame 1

-4.17

No. of Spectra

38

CPC Coding Probability

0.313135

PhyloCSF Frame 2 

-4.597

CNTI Index

noncoding

Max Probability

0.889

PhyloCSF Frame 3

-4.436

CNTI Score

-0.345648699