McDonnell Genome Institute

Washington University

Transcript

lnc-ZCCHC7-5:1

Chromosome

chr9

Gene Name

lnc-ZCCHC7-5

Start

37046834

CPC Label

noncoding

End

37047237

Cancer

CCRC

Strand

+

Peptide

LMSNIGYGSNK

Modified Peptide

n[230]LM[147]SNIGYGSNK

Peptide Length

11

ORF Length

81

Open Reading Frame (ORF)

LMSNIGYGSNKKTKHMLPSSLQKFLVHNVKELEVLLRCNKSYCAEIAYNVSSKNHKAIVERAAQLAIRLTSHKARLCSKEN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.109886

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7736

PhyloCSF Frame 3

0

CNTI Score

-0.319195103