McDonnell Genome Institute

Washington University

Transcript

lnc-ZCCHC17-7:2

Chromosome

chr1

Gene Name

lnc-ZCCHC17-7

Start

31287703

CPC Label

noncoding

End

31288930

Cancer

OV

Strand

+

Peptide

DTYITVTVLFFETESR

Modified Peptide

n[145]DTYITVTVLFFETESR

Peptide Length

16

ORF Length

80

Open Reading Frame (ORF)

LLVEILITALKDTYITVTVLFFETESRSVAQAGVQWCNLCKLHLPGAHHSPASASQATGTTGARHHARLIFCIFSRDGVS

Conservation Score

0.483

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.049538

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6387

PhyloCSF Frame 3

0

CNTI Score

-0.338038378