McDonnell Genome Institute

Washington University

Transcript

lnc-ZCCHC17-17:3

Chromosome

chr1

Gene Name

lnc-ZCCHC17-17

Start

31155092

CPC Label

noncoding

End

31160745

Cancer

OV

Strand

+

Peptide

ALEQVLPCVGLVSASVK

Modified Peptide

n[145]ALEQVLPCVGLVSASVK

Peptide Length

17

ORF Length

173

Open Reading Frame (ORF)

LGVWGLGVWGSGGTYLGEAKVGAGGGTRVPGEAGGESPLERGPFGGWRPGSLEGPLAPERGRAQGRNGGEAWPQEPGAAGSGRDPLWGNPRVARERPGGGAEGGAGATWSLRAPPALGRAPPALGRAPLSLSAALLAPPHVCPENPQVPGCAAPRRALEQVLPCVGLVSASVK

Conservation Score

0.033

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0655704

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6495

PhyloCSF Frame 3

0

CNTI Score

0.642504766