McDonnell Genome Institute

Washington University

Transcript

lnc-ZCCHC13-8:1

Chromosome

chrX

Gene Name

lnc-ZCCHC13-8

Start

74209202

CPC Label

noncoding

End

74216879

Cancer

OV

Strand

+

Peptide

INIQLYHVCGLK

Modified Peptide

n[145]INIQLYHVCGLK

Peptide Length

12

ORF Length

38

Open Reading Frame (ORF)

LYAESGKKSKTKINIQLYHVCGLKTKYCEDVNFLQIHL

Conservation Score

0.239

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0485106

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6301

PhyloCSF Frame 3

0

CNTI Score

-0.361173646