McDonnell Genome Institute

Washington University

Transcript

lnc-ZCCHC13-6:1

Chromosome

chrX

Gene Name

lnc-ZCCHC13-6

Start

74218636

CPC Label

noncoding

End

74221621

Cancer

CCRC

Strand

+

Peptide

GQANSRRSPQLPSK

Modified Peptide

GQANSRRSPQLPSK

Peptide Length

14

ORF Length

46

Open Reading Frame (ORF)

LGLNVVKRSQKKGQANSRRSPQLPSKLTQKLKDHLLGMLSRDLNWG

Conservation Score

0.31

PhyloCSF Frame 1

-5.57

No. of Spectra

1

CPC Coding Probability

0.0398048

PhyloCSF Frame 2 

-6.273

CNTI Index

noncoding

Max Probability

0.1692

PhyloCSF Frame 3

-4.769

CNTI Score

-0.405360458