McDonnell Genome Institute

Washington University

Transcript

lnc-ZCCHC13-5:1

Chromosome

chrX

Gene Name

lnc-ZCCHC13-5

Start

74228012

CPC Label

noncoding

End

74229411

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

NANSETIRK

Modified Peptide

n[145]NANSETIRK

Peptide Length

9

ORF Length

122

Open Reading Frame (ORF)

LTKGIYKYCIASSVNLGKKKKKKTIQLTSFNSQNLIVLPLVRNKSRMTALATSVPVFAMVIRQEKEIKKINAIGKRVQLSIFIGDINIKTQRNPQKNANSETIRKAFPISSETLEDTRSTEN

Conservation Score

0.99

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.0911262

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9787

PhyloCSF Frame 3

0

CNTI Score

-0.390746148