McDonnell Genome Institute

Washington University

Transcript

lnc-ZCCHC13-4:1

Chromosome

chrX

Gene Name

lnc-ZCCHC13-4

Start

74233903

CPC Label

noncoding

End

74237437

Cancer

BRCA-Luminal B

Strand

+

Peptide

LCTTELVIR

Modified Peptide

n[145]LCTTELVIR

Peptide Length

9

ORF Length

45

Open Reading Frame (ORF)

MNLQPSISAKCNTAWYKLCTTELVIRHQLSRIPQQIWKGPIYYNL

Conservation Score

0.061

PhyloCSF Frame 1

-5.855

No. of Spectra

28

CPC Coding Probability

0.116728

PhyloCSF Frame 2 

-5.022

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

-4.184

CNTI Score

-0.396413529