McDonnell Genome Institute

Washington University

Transcript

lnc-ZCCHC13-13:1

Chromosome

chrX

Gene Name

lnc-ZCCHC13-13

Start

74121011

CPC Label

coding

End

74131923

Cancer

EOGC

Strand

+

Peptide

GIHHIMMFSATFPNEIQMLAR

Modified Peptide

n[145]GIHHIMMFSATFPNEIQMLAR

Peptide Length

21

ORF Length

267

Open Reading Frame (ORF)

LYRYEEVRKFSYQPRVHPCVVYGDADIGQQIQVLEHGCHLLVATPGGLVDLMERGKIGLDFCKYLVLDEADRMLDMGFGPQIHLILEQDTMPLKGIHHIMMFSATFPNEIQMLARDFLDEYIFLAVGRVGSTSETITQEVVWVEEPDKRSFLLDLLNAPGKDSLTLVFVETKKGEDSLENFLYHEVYPCTSIHGDQSQRDREGGPSSVLLGENPNSSGYSCGSMKTRHFKCETCFNFDLPSDIEEYVPCIGCTGCVGIQGLATSFFN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.999957

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1837

PhyloCSF Frame 3

0

CNTI Score

-0.293675087