McDonnell Genome Institute

Washington University

Transcript

lnc-ZC3HAV1-3:1

Chromosome

chr7

Gene Name

lnc-ZC3HAV1-3

Start

139172515

CPC Label

noncoding

End

139174266

Cancer

OV

Strand

-

Peptide

LSDSSTSPQPK

Modified Peptide

n[145]LSDSSTSPQPK

Peptide Length

11

ORF Length

119

Open Reading Frame (ORF)

LPLLNPSMPQSTESQPTISEPATHKRRKAELEALQSLRWSLSHTTNCDRLSDSSTSPQPKRQQQDTSASITKLFLHLEKKTPVHSRLSSPIPLTPSKEGSTVFAGFEGRKTNEMNEVLS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.234813

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.845

PhyloCSF Frame 3

0

CNTI Score

-0.308214585