McDonnell Genome Institute

Washington University

Transcript

lnc-ZC3H12D-4:10

Chromosome

chr6

Gene Name

lnc-ZC3H12D-4

Start

148260857

CPC Label

noncoding

End

148267883

Cancer

OSCC

Strand

-

Peptide

MMTQEEK

Modified Peptide

n[145]MMTQEEK

Peptide Length

7

ORF Length

68

Open Reading Frame (ORF)

LAWKCHIGCNTTPVCVLNERSQKFVRERMMTQEEKWVLLCMRETFRIDLDFESDIAVLFRKTDILYRN

Conservation Score

0.995

PhyloCSF Frame 1

0

No. of Spectra

42

CPC Coding Probability

0.119661

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

0

CNTI Score

-0.349095482