McDonnell Genome Institute

Washington University

Transcript

lnc-ZC3H12D-12:1

Chromosome

chr6

Gene Name

lnc-ZC3H12D-12

Start

149112008

CPC Label

noncoding

End

149112672

Cancer

EOGC

Strand

-

Peptide

LDIISEMCGTFADK

Modified Peptide

n[145]LDIISEM[147]CGTFADK

Peptide Length

14

ORF Length

34

Open Reading Frame (ORF)

LDIISEMCGTFADKEKKKAKTVEQTATTTNKRPG

Conservation Score

1

PhyloCSF Frame 1

-4.338

No. of Spectra

13

CPC Coding Probability

0.293889

PhyloCSF Frame 2 

-5.311

CNTI Index

noncoding

Max Probability

0.9128

PhyloCSF Frame 3

-4.293

CNTI Score

-0.373079497