McDonnell Genome Institute

Washington University

Transcript

lnc-ZC3H12C-1:6

Chromosome

chr11

Gene Name

lnc-ZC3H12C-1

Start

109946568

CPC Label

noncoding

End

109979053

Cancer

HCC

Strand

+

Peptide

GDGASEHR

Modified Peptide

n[230]GDGASEHR

Peptide Length

8

ORF Length

61

Open Reading Frame (ORF)

MNRRAEEQQNGGAEKRGDGASEHREEFGWGWLERISAARWPNSRERSSSHSIPFPAPHPSH

Conservation Score

0.319

PhyloCSF Frame 1

0

No. of Spectra

357

CPC Coding Probability

0.145366

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

-0.333276859