McDonnell Genome Institute

Washington University

Transcript

lnc-ZC3H11B-1:8

Chromosome

chr1

Gene Name

lnc-ZC3H11B-1

Start

219409522

CPC Label

noncoding

End

219459194

Cancer

HCC

Strand

-

Peptide

LGLQNAK

Modified Peptide

n[230]LGLQNAK

Peptide Length

7

ORF Length

40

Open Reading Frame (ORF)

LGLQNAKDSSKSNCVRNWWVLGLTDFKNEATDPGGECYSS

Conservation Score

0.929

PhyloCSF Frame 1

0

No. of Spectra

31

CPC Coding Probability

0.134017

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

0

CNTI Score

-0.375979496