McDonnell Genome Institute

Washington University

Transcript

lnc-ZC2HC1B-1:1

Chromosome

chr6

Gene Name

lnc-ZC2HC1B-1

Start

144002899

CPC Label

noncoding

End

144008730

Cancer

OV

Strand

+

Peptide

VLMQEWIISPSGK

Modified Peptide

n[145]VLMQEWIISPSGK

Peptide Length

13

ORF Length

49

Open Reading Frame (ORF)

MVLMQEWIISPSGKNRVQKQTQIYDHSFINKVPTQFNGKRKVLFFSINV

Conservation Score

0.914

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.161202

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8014

PhyloCSF Frame 3

0

CNTI Score

0.743522268