McDonnell Genome Institute

Washington University

Transcript

lnc-ZBTB2-7:1

Chromosome

chr6

Gene Name

lnc-ZBTB2-7

Start

150839631

CPC Label

coding

End

150865601

Cancer

BRCA-Basal-like

Strand

-

Peptide

NLLDLFRTPFNTSVK

Modified Peptide

n[145]NLLDLFRTPFNTSVK

Peptide Length

15

ORF Length

80

Open Reading Frame (ORF)

MNLLDLFRTPFNTSVKIWMDGEASYSWSMDTGIHMASLALTGRIQCCQLKVESMQVNNLQFSQVIVWESGLITIFPTTSI

Conservation Score

0.503

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.514567

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0528

PhyloCSF Frame 3

0

CNTI Score

-0.315216551