McDonnell Genome Institute

Washington University

Transcript

lnc-ZBTB18-2:2

Chromosome

chr1

Gene Name

lnc-ZBTB18-2

Start

243917391

CPC Label

coding

End

243954589

Cancer

OV

Strand

+

Peptide

GAIDIHR

Modified Peptide

n[145]GAIDIHR

Peptide Length

7

ORF Length

47

Open Reading Frame (ORF)

MEIKRKCKQCVNIAKGAIDIHRDYFSFSIGLKVFKIKFRRKRFNSSW

Conservation Score

0.248

PhyloCSF Frame 1

-4.435

No. of Spectra

11

CPC Coding Probability

0.614814

PhyloCSF Frame 2 

-5.582

CNTI Index

coding

Max Probability

0.9981

PhyloCSF Frame 3

-4.195

CNTI Score

0.622273148