McDonnell Genome Institute

Washington University

Transcript

lnc-ZBTB11-1:1

Chromosome

chr3

Gene Name

lnc-ZBTB11-1

Start

101599242

CPC Label

noncoding

End

101599644

Cancer

OV

Strand

-

Peptide

AISHQSQCEAVQR

Modified Peptide

n[145]AISHQSQCEAVQR

Peptide Length

13

ORF Length

80

Open Reading Frame (ORF)

LMPNTGYESSKKTKHMLPSGFWKFLIYNVRELEVLLMCNKSYCAAITHNVSSKNRKAILERGAQRAISHQSQCEAVQRRK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.211063

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7181

PhyloCSF Frame 3

0

CNTI Score

0.650464988