McDonnell Genome Institute

Washington University

Transcript

lnc-ZAP70-4:1

Chromosome

chr2

Gene Name

lnc-ZAP70-4

Start

97827247

CPC Label

noncoding

End

97827545

Cancer

EOGC

Strand

+

Peptide

VSSAEAAAK

Modified Peptide

n[145]VSSAEAAAK

Peptide Length

9

ORF Length

99

Open Reading Frame (ORF)

MPKRKVSSAEAAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKNVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.12089

PhyloCSF Frame 2 

2.861

CNTI Index

noncoding

Max Probability

0.7683

PhyloCSF Frame 3

0

CNTI Score

-0.303935978