McDonnell Genome Institute

Washington University

Transcript

lnc-YWHAG-1:1

Chromosome

chr7

Gene Name

lnc-YWHAG-1

Start

76195125

CPC Label

noncoding

End

76196022

Cancer

LUAD

Strand

-

Peptide

LGGITGGR

Modified Peptide

n[230]LGGITGGR

Peptide Length

8

ORF Length

62

Open Reading Frame (ORF)

LGGITGGRVSSQAQKVGRMWLTPWDEWDLESDPGPEPDLLLCSHVDLGKSPGASVSSSVKWG

Conservation Score

1

PhyloCSF Frame 1

-3.383

No. of Spectra

4

CPC Coding Probability

0.112465

PhyloCSF Frame 2 

-5.182

CNTI Index

noncoding

Max Probability

0.6687

PhyloCSF Frame 3

-4.528

CNTI Score

-0.373892178