McDonnell Genome Institute

Washington University

Transcript

lnc-YTHDF1-2:1

Chromosome

chr20

Gene Name

lnc-YTHDF1-2

Start

63166796

CPC Label

noncoding

End

63180903

Cancer

PRAD

Strand

-

Peptide

KASMPQPRPCTFVLTLATGR

Modified Peptide

KASMPQPRPCTFVLTLATGR

Peptide Length

20

ORF Length

58

Open Reading Frame (ORF)

MKASMPQPRPCTFVLTLATGRRRVCEVSALQGPSPPELKAFFLLSPPDSLALLVHPGA

Conservation Score

0.315

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0299245

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3686

PhyloCSF Frame 3

0

CNTI Score

-0.299515369