McDonnell Genome Institute

Washington University

Transcript

lnc-YTHDF1-1:1

Chromosome

chr20

Gene Name

lnc-YTHDF1-1

Start

63188374

CPC Label

coding

End

63193710

Cancer

OSCC

Strand

-

Peptide

VQGTGVGNGVLR

Modified Peptide

n[145]VQGTGVGNGVLR

Peptide Length

12

ORF Length

159

Open Reading Frame (ORF)

LATTCETRKSVASVLWNCQAWKRRLSVGGQQLFLWNSIPRLALWRVQVLWDSVPRLALWRLQVLWDSVPRLALWRLQVLWDSVPRLALWRVQGTGVGNGVLRGEKCLGSVSSPDRRGRPELVSWFPCLPQVPASAVMFSSREETSRCSLLLGLVQAGLT

Conservation Score

0.552

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.974299

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5759

PhyloCSF Frame 3

0

CNTI Score

-0.31775316