McDonnell Genome Institute

Washington University

Transcript

lnc-YTHDC1-1:1

Chromosome

chr4

Gene Name

lnc-YTHDC1-1

Start

68304342

CPC Label

noncoding

End

68304939

Cancer

LUAD

Strand

-

Peptide

NLCQETYSQTKPK

Modified Peptide

n[230]NLCQETYSQTKPK

Peptide Length

13

ORF Length

103

Open Reading Frame (ORF)

MFKVIRRSVRPTSLRLFTFKVYAAPKKDSPPQNPMKVDELSLYSVPEGQSKCVEESRSQLEVGISQFRRYCEPHRNLCQETYSQTKPKMQSLVQWGLDSYEYL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.300866

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8689

PhyloCSF Frame 3

0

CNTI Score

-0.374932601