McDonnell Genome Institute

Washington University

Transcript

lnc-YRDC-1:1

Chromosome

chr1

Gene Name

lnc-YRDC-1

Start

37799719

CPC Label

noncoding

End

37800879

Cancer

OV

Strand

-

Peptide

GETIGGK

Modified Peptide

n[145]GETIGGK

Peptide Length

7

ORF Length

150

Open Reading Frame (ORF)

LLRPAACQLQVQAGLVRQVVQIQAGGCLLGNGLLNLGALVPLIEGGNGNDLGPHCQGRLQGRLIVLAIDPVARIVVVPGPNAGVYVARPHTGDEHEVVGITKVLHSFPVLMGRTKGETIGGKVGVHAVKSGGQDIVGVALLHQQRYEDPI

Conservation Score

1

PhyloCSF Frame 1

-1.882

No. of Spectra

1

CPC Coding Probability

0.0378302

PhyloCSF Frame 2 

-3.731

CNTI Index

coding

Max Probability

0.558

PhyloCSF Frame 3

13.384

CNTI Score

0.653099928