McDonnell Genome Institute

Washington University

Transcript

lnc-YKT6-3:1

Chromosome

chr7

Gene Name

lnc-YKT6-3

Start

44194276

CPC Label

noncoding

End

44198237

Cancer

OV

Strand

+

Peptide

LTSPRSGPLMSQPK

Modified Peptide

n[145]LTSPRSGPLM[147]SQPK

Peptide Length

14

ORF Length

40

Open Reading Frame (ORF)

LEPVQNRLTSPRSGPLMSQPKFPQLVLYHLLNLHVTLEAA

Conservation Score

0.147

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0924323

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2119

PhyloCSF Frame 3

0

CNTI Score

-0.395144224