McDonnell Genome Institute

Washington University

Transcript

lnc-YES1-9:1

Chromosome

chr18

Gene Name

lnc-YES1-9

Start

1362444

CPC Label

noncoding

End

1363873

Cancer

CCRC

Strand

-

Peptide

FINLEPSTLTNK

Modified Peptide

n[230]FINLEPSTLTNK

Peptide Length

12

ORF Length

64

Open Reading Frame (ORF)

LIAKATAKEAGCRFINLEPSTLTNKWYGESQTLAAAVFSLAIKLQLSIIIIDEIDSFVRNRSEF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.445473

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9459

PhyloCSF Frame 3

0

CNTI Score

-0.338972857