McDonnell Genome Institute

Washington University

Transcript

lnc-YEATS2-1:1

Chromosome

chr3

Gene Name

lnc-YEATS2-1

Start

183635622

CPC Label

noncoding

End

183643231

Cancer

LUAD

Strand

+

Peptide

EVPGVTAPGPAERR

Modified Peptide

n[230]EVPGVTAPGPAERR

Peptide Length

14

ORF Length

61

Open Reading Frame (ORF)

LLAASSVRREVPGVTAPGPAERRGTGSPGECDRLKSSLLVWWDDRRFCPGGMTGSRNFTAG

Conservation Score

1

PhyloCSF Frame 1

-2.547

No. of Spectra

1

CPC Coding Probability

0.0141863

PhyloCSF Frame 2 

-0.85

CNTI Index

noncoding

Max Probability

0.9953

PhyloCSF Frame 3

-1.315

CNTI Score

-0.339277209