McDonnell Genome Institute

Washington University

Transcript

lnc-XRCC2-9:1

Chromosome

chr7

Gene Name

lnc-XRCC2-9

Start

153042166

CPC Label

noncoding

End

153044896

Cancer

OV

Strand

-

Peptide

EGHIPERSIAPTHR

Modified Peptide

n[145]EGHIPERSIAPTHR

Peptide Length

14

ORF Length

37

Open Reading Frame (ORF)

MVGVSWKDDSGCIREGHIPERSIAPTHRWWLEPGCLP

Conservation Score

0.009

PhyloCSF Frame 1

-4.756

No. of Spectra

16

CPC Coding Probability

0.118912

PhyloCSF Frame 2 

-3.96

CNTI Index

noncoding

Max Probability

0.9934

PhyloCSF Frame 3

-5.67

CNTI Score

-0.291141546