McDonnell Genome Institute

Washington University

Transcript

lnc-XRCC2-13:1

Chromosome

chr7

Gene Name

lnc-XRCC2-13

Start

152391177

CPC Label

coding

End

152409561

Cancer

BRCA-Luminal B

Strand

-

Peptide

STLATIFFFLFLR

Modified Peptide

n[145]STLATIFFFLFLR

Peptide Length

13

ORF Length

98

Open Reading Frame (ORF)

MYSINYIVYIQSTKSTLATIFFFLFLRWSLTLSPRLECSGTILAHCNLYLPGFSDSHASASQVAGITGTRHHTHLIFVFLVETGFRHIGQAGLELLTL

Conservation Score

0.13

PhyloCSF Frame 1

0

No. of Spectra

15

CPC Coding Probability

0.751269

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9964

PhyloCSF Frame 3

0

CNTI Score

0.615022366