McDonnell Genome Institute

Washington University

Transcript

lnc-XRCC2-10:1

Chromosome

chr7

Gene Name

lnc-XRCC2-10

Start

152275924

CPC Label

noncoding

End

152277331

Cancer

OV

Strand

-

Peptide

SLENSSDSFLK

Modified Peptide

n[145]SLENSSDSFLK

Peptide Length

11

ORF Length

91

Open Reading Frame (ORF)

MNCGIFNFLVFFYDTTLISNFVHSVLFYGYILTDYFKLLNKSLENSSDSFLKLVIRVLTEFLLLLLLCSWINMGKYYYNMLLFSFSYSLSF

Conservation Score

0.537

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.112458

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8064

PhyloCSF Frame 3

0

CNTI Score

-0.396587122