McDonnell Genome Institute

Washington University

Transcript

lnc-XPOT-4:1

Chromosome

chr12

Gene Name

lnc-XPOT-4

Start

64222336

CPC Label

noncoding

End

64397065

Cancer

CRC

Strand

+

Peptide

LSSPAPSVDAPPSK

Modified Peptide

‚Äč

Peptide Length

14

ORF Length

39

Open Reading Frame (ORF)

LWQARRLSSPAPSVDAPPSKTFPSRPCAQFGSRQSMQEE

Conservation Score

1

PhyloCSF Frame 1

-4.586

No. of Spectra

1

CPC Coding Probability

0.047409

PhyloCSF Frame 2 

-5.352

CNTI Index

noncoding

Max Probability

0.6957

PhyloCSF Frame 3

-5.108

CNTI Score

-0.306038728