McDonnell Genome Institute

Washington University

Transcript

lnc-XPOT-1:2

Chromosome

chr12

Gene Name

lnc-XPOT-1

Start

64147111

CPC Label

noncoding

End

64147833

Cancer

OV

Strand

+

Peptide

DCAFLTPVSSHPTASVPR

Modified Peptide

n[145]DCAFLTPVSSHPTASVPR

Peptide Length

18

ORF Length

130

Open Reading Frame (ORF)

LLLYRCPALCPTPTSSSQFLLPTRVFRSFLPVPHLPHPRLPVPRCSVMSHLTSLSVLRLSRFPCRRDCAFLTPVSSHPTASVPRSCAADSIAFARALYCLSPFHSLLSEVKIKGDAFTVWKEKKCFVNLL

Conservation Score

1

PhyloCSF Frame 1

-3.386

No. of Spectra

1

CPC Coding Probability

0.0767892

PhyloCSF Frame 2 

-1.386

CNTI Index

noncoding

Max Probability

0.9691

PhyloCSF Frame 3

1.206

CNTI Score

-0.409181587