McDonnell Genome Institute

Washington University

Transcript

lnc-XPC-7:1

Chromosome

chr3

Gene Name

lnc-XPC-7

Start

14141442

CPC Label

noncoding

End

14144509

Cancer

LUAD

Strand

-

Peptide

KTGNQSTVER

Modified Peptide

n[230]KTGNQSTVER

Peptide Length

10

ORF Length

38

Open Reading Frame (ORF)

MLTRSRKTGNQSTVERRKVMRCHLLYTSPAQQISPVPR

Conservation Score

1

PhyloCSF Frame 1

-4.505

No. of Spectra

5

CPC Coding Probability

0.026627

PhyloCSF Frame 2 

-5.051

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

10.833

CNTI Score

-0.315176667