McDonnell Genome Institute

Washington University

Transcript

lnc-XKR6-1:1

Chromosome

chr8

Gene Name

lnc-XKR6-1

Start

10893496

CPC Label

noncoding

End

10896846

Cancer

CCRC

Strand

-

Peptide

TLTQADLRPER

Modified Peptide

n[230]TLTQADLRPER

Peptide Length

11

ORF Length

107

Open Reading Frame (ORF)

LSQQHGYQDTGRTLTQADLRPERKRRHLPCPDMPPSQHSLGQGRRHFPMAWGSPTPHLPRHRIIQDPMVLMALTQSLPSRGPSESHDPVWPVVMKVIPLARGHLMPQ

Conservation Score

0.541

PhyloCSF Frame 1

-5.294

No. of Spectra

1

CPC Coding Probability

0.0509804

PhyloCSF Frame 2 

-1.789

CNTI Index

noncoding

Max Probability

0.0776

PhyloCSF Frame 3

-5.271

CNTI Score

-0.360704835