McDonnell Genome Institute

Washington University

Transcript

lnc-XIRP2-2:2

Chromosome

chr2

Gene Name

lnc-XIRP2-2

Start

167536958

CPC Label

noncoding

End

167538972

Cancer

BRCA-Luminal A

Strand

+

Peptide

SYLMAGR

Modified Peptide

n[145]SYLMAGR

Peptide Length

7

ORF Length

36

Open Reading Frame (ORF)

MSSSVRSYLMAGRRACAGKLPFIKPSGLMRLIHSLP

Conservation Score

0.039

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.0368596

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9949

PhyloCSF Frame 3

0

CNTI Score

-0.383872984