McDonnell Genome Institute

Washington University

Transcript

lnc-WWC2-2:1

Chromosome

chr4

Gene Name

lnc-WWC2-2

Start

183097456

CPC Label

noncoding

End

183098030

Cancer

EOGC

Strand

+

Peptide

LSLSTFEIGR

Modified Peptide

n[145]LSLSTFEIGR

Peptide Length

10

ORF Length

40

Open Reading Frame (ORF)

LSLSTFEIGRRCPDGMAWGAESCPQPRTATAHAAQASLTQ

Conservation Score

0.217

PhyloCSF Frame 1

0

No. of Spectra

22

CPC Coding Probability

0.168256

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

-4.138

CNTI Score

-0.346407592