McDonnell Genome Institute

Washington University

Transcript

lnc-WSB1-6:1

Chromosome

chr17

Gene Name

lnc-WSB1-6

Start

27281093

CPC Label

noncoding

End

27281415

Cancer

CCRC

Strand

+

Peptide

AAGLVSK

Modified Peptide

n[230]AAGLVSK

Peptide Length

7

ORF Length

84

Open Reading Frame (ORF)

LNEVGTVNDLLKYEKKFPSEKAAGLVSKSLQFENTSCLVWSKYNDVLQGISLPKGAAIQKGVKDKPTNPTGLYTWLRALPASGL

Conservation Score

0.293

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.0125374

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9933

PhyloCSF Frame 3

0

CNTI Score

-0.331094707