McDonnell Genome Institute

Washington University

Transcript

lnc-WSB1-2:1

Chromosome

chr17

Gene Name

lnc-WSB1-2

Start

27337150

CPC Label

noncoding

End

27339000

Cancer

BRCA-Luminal B

Strand

+

Peptide

TNLGLEVLK

Modified Peptide

n[145]TNLGLEVLK

Peptide Length

9

ORF Length

46

Open Reading Frame (ORF)

LKGESPKEEKQCPQESTSKRTSNFLADAEACKTNLGLEVLKEKILI

Conservation Score

0.908

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.0814181

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

0

CNTI Score

-0.290578021