McDonnell Genome Institute

Washington University

Transcript

lnc-WRNIP1-7:1

Chromosome

chr6

Gene Name

lnc-WRNIP1-7

Start

2818551

CPC Label

noncoding

End

2819730

Cancer

OV

Strand

+

Peptide

MCISSATVESSLETSQRT

Modified Peptide

n[145]MCISSATVESSLETSQRT

Peptide Length

18

ORF Length

35

Open Reading Frame (ORF)

MLVRLRRKGKIYTLLVRMCISSATVESSLETSQRT

Conservation Score

0.076

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.0386865

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9917

PhyloCSF Frame 3

0

CNTI Score

-0.391231066