McDonnell Genome Institute

Washington University

Transcript

lnc-WRNIP1-29:1

Chromosome

chr6

Gene Name

lnc-WRNIP1-29

Start

2536455

CPC Label

noncoding

End

2542126

Cancer

OV

Strand

+

Peptide

ICQNLITSNYLR

Modified Peptide

n[145]ICQNLITSNYLR

Peptide Length

12

ORF Length

113

Open Reading Frame (ORF)

LVTPPCQLLGPKMLMLFLTLPPHNPGRNHFDSALSSKICQNLITSNYLRHQYGFLFWTTTVSFPAGVPDATPAPKVHYEHSSHSNSLKMGLTLCHSCPLFKHCSQSFKRSSKP

Conservation Score

0.231

PhyloCSF Frame 1

-4.22

No. of Spectra

1

CPC Coding Probability

0.157826

PhyloCSF Frame 2 

-4.943

CNTI Index

noncoding

Max Probability

0.1115

PhyloCSF Frame 3

-4.665

CNTI Score

-0.344936