McDonnell Genome Institute

Washington University

Transcript

lnc-WRNIP1-16:1

Chromosome

chr6

Gene Name

lnc-WRNIP1-16

Start

2701124

CPC Label

noncoding

End

2716600

Cancer

OV

Strand

+

Peptide

FCVCLSVESLPLLGEIGVHPMSQGRI

Modified Peptide

n[145]FCVCLSVESLPLLGEIGVHPM[147]SQGRI

Peptide Length

26

ORF Length

41

Open Reading Frame (ORF)

MEQCTESFLHGQKRRFCVCLSVESLPLLGEIGVHPMSQGRI

Conservation Score

0.998

PhyloCSF Frame 1

-5.805

No. of Spectra

6

CPC Coding Probability

0.142402

PhyloCSF Frame 2 

-4.787

CNTI Index

noncoding

Max Probability

0.794

PhyloCSF Frame 3

-2.665

CNTI Score

-0.346514912