McDonnell Genome Institute

Washington University

Transcript

lnc-WRNIP1-10:1

Chromosome

chr6

Gene Name

lnc-WRNIP1-10

Start

2829846

CPC Label

noncoding

End

2830633

Cancer

OV

Strand

+

Peptide

ESSYGFLAFIISVDICVDIVIAASLK

Modified Peptide

n[145]ESSYGFLAFIISVDICVDIVIAASLK

Peptide Length

26

ORF Length

63

Open Reading Frame (ORF)

LARYLDFVFSNILRESSYGFLAFIISVDICVDIVIAASLKVLWPFLRLLSFYDFSLSLWMSAV

Conservation Score

0.183

PhyloCSF Frame 1

-4.544

No. of Spectra

1

CPC Coding Probability

0.0779156

PhyloCSF Frame 2 

-4.75

CNTI Index

noncoding

Max Probability

0.3754

PhyloCSF Frame 3

-4.576

CNTI Score

-0.558469193