McDonnell Genome Institute

Washington University

Transcript

lnc-WRN-4:5

Chromosome

chr8

Gene Name

lnc-WRN-4

Start

31207451

CPC Label

noncoding

End

31222976

Cancer

GBM

Strand

+

Peptide

ASLEEAGAR

Modified Peptide

n[230]ASLEEAGAR

Peptide Length

9

ORF Length

52

Open Reading Frame (ORF)

MRIKLGPKASLEEAGARSQLAAPPPLTFWSSYFSWFTFPRGYHISTQRLSLS

Conservation Score

0.053

PhyloCSF Frame 1

-4.535

No. of Spectra

2

CPC Coding Probability

0.218695

PhyloCSF Frame 2 

-3.889

CNTI Index

noncoding

Max Probability

0.8365

PhyloCSF Frame 3

-5.41

CNTI Score

-0.329846063