McDonnell Genome Institute

Washington University

Transcript

lnc-WRB-8:1

Chromosome

chr21

Gene Name

lnc-WRB-8

Start

39127567

CPC Label

noncoding

End

39128040

Cancer

BRCA-Luminal A

Strand

+

Peptide

LYDIDMIK

Modified Peptide

n[145]LYDIDMIK

Peptide Length

8

ORF Length

154

Open Reading Frame (ORF)

LKAKKEVPAPPKAKAKAKALKAKKAVLKGVHNHKKKKIHTSPTFRRPKTLQLRRQPKYPWKSTPRRNKLDHYAIIKFPLTTESAMKKTGDNNTRVFMVDVKANKHQIKQAVKRLYDIDMIKVNTLIWPDGEKKAYVPLAPDYDALDVANKIGII

Conservation Score

1

PhyloCSF Frame 1

-1.629

No. of Spectra

4

CPC Coding Probability

0.142453

PhyloCSF Frame 2 

-3.836

CNTI Index

coding

Max Probability

0.7434

PhyloCSF Frame 3

0

CNTI Score

0.735020235